P-Selectin/CD62P Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85745PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85745PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all P-Selectin/CD62P Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SELP.

Source: E. coli

Amino Acid Sequence: EAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85745.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-85745PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: P-Selectin/CD62P

CD62P is a member of the small selectin family of cellular adhesion molecules, which also includes CD62E and CD62L. Its structure, similar to the other members of the selectin family, consists of an N terminal lectin like domain of C type, followed by an epidermal growth factor like motif, a series of short consensus repeats, a transmembrane domain, and a cytoplasmic tail. The CD62P antigen is a 140 kDa glycoprotein, located in the alpha granules and the dense granules of platelets and endothelial cells. Activation of these cells results in rapid mobilization of CD62P from the storage granules to the cell surface. Activated platelets have a stable CD62P expression, while the endothelial cells lose CD62P expression within 1 h of activation, because of endocytosis of the molecule. CD62P is also expressed on megakaryocytes, but resting platelets and endothelial cells show no surface staining of CD62P.

Alternate Names

CD62P, GMP140, GRMP, PADGEM, PSEL, SELP

Gene Symbol

SELP

Additional P-Selectin/CD62P Products

Product Documents for P-Selectin/CD62P Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for P-Selectin/CD62P Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.