Recombinant Human p114RhoGEF GST (N-Term) Protein

Name: Recombinant Human p114RhoGEF GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00023370-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00023370-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all p114RhoGEF Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-89 of Human ARHGEF18

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human p114RhoGEF GST (N-Term) Protein

SDS-PAGE: Recombinant Human p114RhoGEF GST (N-Term) Protein [H00023370-P01]

SDS-Page: Recombinant Human p114RhoGEF Protein [H00023370-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00023370-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: p114RhoGEF

Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

114 kDa Rho-specific guanine nucleotide exchange factor, EC 3.4.24, EC 3.6.1, KIAA0521rho guanine nucleotide exchange factor 18, MGC15913, p114RhoGEF, P114-RhoGEF, P114-RHO-GEF, Rho/Rac guanine nucleotide exchange factor (GEF) 18, Rho/Rac guanine nucleotide exchange factor 18, Rho-specific guanine nucleotide exchange factor p114, SA-RhoGEF, Septin-associated RhoGEF

Gene Symbol

ARHGEF18

Additional p114RhoGEF Products

Product Documents for Recombinant Human p114RhoGEF GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human p114RhoGEF GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews