P2Y11/P2RY11 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87465PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87465PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all P2Y11/P2RY11 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P2RY11.

Source: E. coli

Amino Acid Sequence: VLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87465.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87465PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: P2Y11/P2RY11

P2Y11, the only Purinergic Receptor that acts via cAMP, may be involved in the differentiation of immunocytes. Immature and mature dendritic cells express P2Y and P2X subtypes, including P2Y11, which are coupled to increases in intracellular Ca2+, membrane depolarization, and secretion of inflammatory cytokines. It has been suggested that ATP/P2Y11 contributes to sympathetic stimulation of renin, as well as to renin responses after tissue damage, such as that which occurs with kidney disease and myocardial infarct. Intergenic splicing between the P2Y11 and SSF1 genes changes gene expression, the first case involving a GPCR Communi et al., 2001. Prototypes for this cluster have been chosen to be uniquely P2Y11. P2Y11 has been reported in monocyte-derived dendritic cells, lymphocytes from patients with chronic lymphocytic leukemia, brain, heart, kidney, liver, skeletal muscle, spleen, and testis. ESTs have been isolated from normal human prostate, pancreas, and pooled brain, lung, and testis libraries.

Long Name

P2Y Purinergic Receptor 11

Alternate Names

P2RY11

Gene Symbol

P2RY11

Additional P2Y11/P2RY11 Products

Product Documents for P2Y11/P2RY11 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for P2Y11/P2RY11 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.