Recombinant Human PCYT1B GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00009468-P01

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00009468-P01 has been discontinued. View all PCYT1B products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all PCYT1B Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-369 of Human PCYT1B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

68.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PCYT1B GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00009468-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: PCYT1B

TCP1 beta is a subunit of a cytosolic hetero-oligomer chaperon that is known to be involved in the folding of actin and tubulin. This protein is a member of the chaperonin family, which includes Escherichia coli GroEL, the mitochondrial heat-shock protein Hsp60, the plastid Rubisco-subunit-binding protein and the archaebacterial protein TF55. These chaperonins assist the folding of proteins upon ATP hydrolysis. Nine different subunits of TCP-1 containing chaperonin complexes from mammalian testis and seven different subunits of mouse F9 cells have been identified. It has been suggested that each CCT subunit has a specific, independent function, as they are highly diverged from each other but conserved from mammals to yeast. The expansion in the number of types of CCT subunit, compared with other chaperonins, has allowed CCT to carry out more complex functions that are required for the folding and assembly of highly evolved eukaryotic proteins.

Alternate Names

CCT B, CCTB, CCT-betaEC 2.7.7.15, choline-phosphate cytidylyltransferase B, CT B, CTB, CTP:phosphocholine cytidylyltransferase B, EC 2.7.7, phosphate cytidylyltransferase 1, choline, beta, phosphate cytidylyltransferase 1, choline, beta isoform, Phosphorylcholine transferase B

Gene Symbol

PCYT1B

Additional PCYT1B Products

Product Documents for Recombinant Human PCYT1B GST (N-Term) Protein

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human PCYT1B GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.