Skip to main content

PDE4B Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84057PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84057PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE4B.

Source: E. coli

Amino Acid Sequence: SGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84057.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84057PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PDE4B

PDE4B is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Enzymes of the cAMP-dependent phosphodiesterase type 4 (PDE4) family are important in hydrolyzing cAMP produced by G-protein coupled receptor (GPCR) stimulated adenylyl cyclases. Four genes (PDE4A, B, C and D) make up the PDE4 family. cAMP-dependent phosphodiesterase type B (PDE4B) family consists of four known splice variants, PDE4B1, B2, B3 and a novel 66 kDa PDE4B4 protein. One or more subtype variants of PDE4B are ubiquitously present in all mammalian cells. In CNS, all four PDE4B subtype variants are expressed in varying ratios and their activity is regulated in tandem with GPCRs stimulation. Some PDE4B variants are also substrate for PKA-dependent phosphorylation. Peripheral tissues exhibit differential expression of PDE4B1, B2 and B4 variants; the PDE4B4 (66kDa protein) is the major PDE4B variant expressed in lungs, testis and heart. In testis PDE4B enzymes are expressed in somatic cells (Sertoli and Leydig cells) while PDE4A is localized in germ cells.

Long Name

cAMP-specific 3',5'-cyclic phosphodiesterase 4B

Alternate Names

DPDE4, PDE32

Gene Symbol

PDE4B

Additional PDE4B Products

Product Documents for PDE4B Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PDE4B Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...