PEAR1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90449PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-90449PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all PEAR1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEAR1.

Source: E. coli

Amino Acid Sequence: PSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTVVYRTVYRQVVKTDHRQRLQCCHGFYES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90449.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-90449PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PEAR1

Platelet endothelial aggregation receptor 1 (PEAR1) is a 150 kDa type I transmembrane protein and member of the MEGF family of proteins. Human PEAR1 is synthesized as a 1037 amino acid (aa) precursor that contains a 20 aa signal sequence, a 735 aa extracellular domain (ECD), a 21 aa transmembrane region, and a 261 aa cytoplasmic region. The ECD consists of 15 EGF-like repeats that vary in length from 39 to 42 aa and contain a consensus sequence of CX1-2GX2GX2-4CX3CX1-3CX1-2GX1-2CX4GX1CX1CX2GX2GX2C. The consensus repeat contains six conserved glycine residues and eight conserved cysteine residues, suggesting four disulfide-bonded cysteine pairs in each EGF repeat. Within the ECD, there are also five potential sites for N-linked glycosylation. The cytoplasmic region contains five potential Src homology 3-binding, proline-rich domains. Mature human PEAR1 is 84% aa identical to mature mouse PEAR1. PEAR1 is most highly expressed in platelets and endothelial cells. Functionally, PEAR1 is a receptor for a yet undetermined ligand that signals upon the formation of platelet-platelet contacts induced both by platelet aggregations and by platelet centrifugation. The signaling enhances and stabilizes platelet thrombi. Upon aggregation, the surface-expressed protein is tyrosine-phosphorylated. This phosphorylation event is inhibited by the alphaIIbbeta3 antagonist eptifibatide, thus demonstrating that PEAR1 tyrosine phosphorylation is dependent on surface contacts between activated platelets. PEAR1 can be phosphorylated in an alphaIIbbeta3 integrin-dependent manner on tyrosine (Tyr925) and serine residues (Ser593 and Ser1029) and, potentially, at Tyr804, Tyr943, and Tyr979. Inherited PEAR1 variations that alter expression or function of the platelet signaling molecule could modify agonist-induced aggregation in native platelets. In addition, a genetic variant in PEAR1 could be an important determinant of residual platelet function during aspirin treatment, because the COX1/thromboxane A2 pathway will be strongly inhibited by aspirin, and maximal aggregation will then be dependent on other secondary signaling pathways.

Long Name

Platelet endothelial aggregation receptor 1

Alternate Names

Jedi

Gene Symbol

PEAR1

Additional PEAR1 Products

Product Documents for PEAR1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PEAR1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.