Skip to main content

Phospholipase C delta 1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87557PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87557PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCD1.

Source: E. coli

Amino Acid Sequence: EAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87557.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87557PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Phospholipase C delta 1

Phospholipase C delta 1, also known by its gene name PLCD1, has a 756 amino acid long isoform that is approximately 86 kDa and a 777 amino acid long isoform that is approximately 88 kDa. Phospholipase C delta 1 is a member of the phospholipase C family and plays a critical role in the production of intercellular second messenger molecules. Phospholipase C delta 1 is a tumor suppressor and mutations in PLCD1 may be a cause of hereditary leukonychia. Currently research on Phospholipase C delta 1 is related to several diseases and disorders including nail disorders, squamous cell carcinoma, Huntington's disease, Alzheimer's disease, colon carcinoma, breast cancer, esophagitis and hypertension. Phospholipase C delta 1 has also been shown to interact with CALM1, CALM2, CALM3, TGM2 and KPNB1 in pathways such as IGF1R signaling, PKA signaling, sweet taste signaling and CREB Pathway.

Long Name

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1

Alternate Names

Phospholipase C-III, PLC-delta-1, PLC-III, PLCD1

Gene Symbol

PLCD1

Additional Phospholipase C delta 1 Products

Product Documents for Phospholipase C delta 1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Phospholipase C delta 1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...