PICK1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57239PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-57239PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all PICK1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PICK1.

Source: E. coli

Amino Acid Sequence: LTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57239.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57239PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PICK1

PSD-95/DLG/ZO-1 (PDZ) domain-containing proteins play a central role in synaptic membrane protein localization. The protein interacting with protein kinase C (PICK 1) is a synaptic PDZ domain protein that also contains a coiled-coil and acidic domain. Studies indicate that PICK 1 functions as a targeting and transport protein and has been shown to interact with protein kinase C alpha (PKC alpha), AMPA-type glutamate receptors, and several other membrane receptors via its PDZ domain. The interaction of PICK 1 with PKC alpha is highly dependent on the activation of the kinase. It appears that PICK 1 directs the activated form of PKC alpha to membrane anchored GluR2. Once phosphorylated by PKC alpha, GluR2 is released from the synaptic anchor proteins. Once released, GluR2 is transported from the synaptic membrane in a PICK 1-dependent manner.

Alternate Names

alpha binding protein, dJ1039K5, MGC15204, PICK, PRKCA-binding protein, PRKCABPprotein interacting with PRKCA, Protein interacting with C kinase 1, protein interacting with PRKCA 1, Protein kinase C-alpha-binding protein

Gene Symbol

PICK1

Additional PICK1 Products

Product Documents for PICK1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PICK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.