PIGL Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86471PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-86471PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all PIGL Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIGL.

Source: E. coli

Amino Acid Sequence: MKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86471.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86471PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PIGL

PIGL, also referred to as N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, is approximately 29 kDa and 252 amino acids in length. PIGL localizes to the endoplasmic reticulum and is an important player the synthesis of GPI anchors as it catalyzes the second step in the reaction. Current research on PIGL is being performed relating to several diseases and disorders including congenital heart disease, babesiosis, ear anomalies syndrome, ichthyosiform dermatosis, malaria and sleeping sickness. PIGL has also been shown to have interactions with PIGA, PIGC, PIGH, DPM2, and GPLD1 in pathways such as GPI anchor biosynthesis and metabolic pathways.

Alternate Names

EC 3.5.1.89, N-acetylglucosaminylphosphatidylinositol deacetylase, N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, phosphatidylinositol glycan anchor biosynthesis, class L, phosphatidylinositol glycan, class L, Phosphatidylinositol-glycan biosynthesis class L protein, PIG-L

Gene Symbol

PIGL

Additional PIGL Products

Product Documents for PIGL Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PIGL Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.