Skip to main content

PMM2/Phosphomannomutase 2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57753PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57753PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PMM2/Phosphomannomutase 2.

Source: E. coli

Amino Acid Sequence: FEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57753.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57753PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PMM2/Phosphomannomutase 2

PMM2, also known as Phosphomannomutase 2, is a 246 amino acid protein that is 28 kDa, catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Studies are being performed on the relationship of this protein to congenital disorder of glycosylation, hydrops fetalis, premature ovarian failure, cerebellar hypoplasia, metabolic disorders, alcohol abuse, intellectual disability, hypertrophic cardiomyopathy, cerebellar ataxia, galactosemia, peripheral neuropathy, hypogonadism, neuropathy, hypotonia, cardiomyopathy, thrombocytopenia, ataxia, alcoholism, and malaria. The PMM2 protein has also shown an interaction with HIST1H4A, HIST1H4B, HIST1H4D, HIST1H4E, HIST1H4C, and over 130 other proteins in synthesis of substrates in N-glycan biosynthesis, asparagine N-linked glycosylation, metabolism of proteins, post-translational protein modification, biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, fructose and mannose metabolism, amino sugar and nucleotide sugar metabolism, GDP-mannose biosynthesis, and colanic acid building blocks biosynthesis pathways.

Alternate Names

CDG1, CDG1A, CDGS, EC 5.4.2.8, phosphomannomutase 2, PMM 2

Gene Symbol

PMM2

Additional PMM2/Phosphomannomutase 2 Products

Product Documents for PMM2/Phosphomannomutase 2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PMM2/Phosphomannomutase 2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...