Skip to main content

POLE4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-54947PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-54947PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLE4.

Source: E. coli

Amino Acid Sequence: VPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54947.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-54947PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: POLE4

POLE4, also known as DNA polymerase epsilon subunit 4, is 117 amino acids long and approximately 12kDa. POLE4 localizes to the nucleus. POLE, POLE2, POLE3 and POLE4 are elements of the epsilon DNA polymerase complex (Pol epsilon), and as such, POLE4 plays a role in the process of nuclear DNA replication. POLE4 interacts with POLE, POLE2, and POLE3, as well as UBE3A and HSPA13. POLE4 is implicated in a variety of pathways including the DNA replication pathway, Nucleotide excision repair, Purine metabolism, and cell cycle control of chromosomal replication.

Alternate Names

DNA polymerase epsilon p12 subunit, DNA polymerase epsilon subunit 4, DNA polymerase epsilon subunit p12, DNA polymerase II subunit 4, EC 2.7.7.7, p12, polymerase (DNA-directed), epsilon 4 (p12 subunit), YHHQ1

Gene Symbol

POLE4

Additional POLE4 Products

Product Documents for POLE4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for POLE4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...