Skip to main content

PPFIA4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-31573PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-31573PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPFIA4.

Source: E. coli

Amino Acid Sequence: PFVDGVHSRSHMGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31573.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-31573PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PPFIA4

PPFIA4, also referred to as Liprin-alpha-4, has a 701 amino acid long isoform that is approximately 78kDa and a slightly shorter 692 amino acid long isoform that is approximately 77kDa. PPFIA4 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family, and is expressed in the skeletal muscle, heart, and brain. Liprin family members, such as PPFIA4, interact with the LAR family of transmembrane PTPs, which are essential players in mammary gland development and axon guidance. Research has shown that PPFIA4 could play a role in the disassembly of focal adhesions. Current research on PPFIA4 is being performed in relation to several diseases and disorders including hypoxia, hypertension, ataxia, and neuronitis. PPFIA4 has also been shown to interact with GIT1, NCOA2, ERC2, PLCG1, and AGTPBP1.

Alternate Names

KIAA0897, liprin alpha4, Liprin-alpha4, liprin-alpha-4, Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-4, protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 4, PTPRF-interacting protein alpha-4

Gene Symbol

PPFIA4

Additional PPFIA4 Products

Product Documents for PPFIA4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PPFIA4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...