PPIH Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-32416PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-32416PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all PPIH Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPIH.

Source: E. coli

Amino Acid Sequence: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32416.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-32416PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PPIH

PPIases accelerate the folding of proteins. It catalyzes the cis trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri snRNP complex. May act as a chaperone. The protein encoded by this gene is a member of the peptidyl prolyl cis trans isomerase (PPIase) family. PPIases catalyze the cis trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.

Alternate Names

cyclophilin H, CYP20, CypH, CYPHpeptidyl prolyl isomerase H (cyclophilin H), EC 5.2.1.8, MGC5016, peptidyl-prolyl cis-trans isomerase H, peptidylprolyl isomerase H (cyclophilin H), PPIase H, Rotamase H, Small nuclear ribonucleoprotein particle-specific cyclophilin H, SnuCyp-20, USA-CyP SnuCyp-20, USA-CYPCYP-20, U-snRNP-associated cyclophilin SnuCyp-20, U-snRNP-associated cyclophilin SunCyp-20

Gene Symbol

PPIH

Additional PPIH Products

Product Documents for PPIH Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PPIH Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.