Skip to main content

PPP2R5D Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88959PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-88959PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP2R5D.

Source: E. coli

Amino Acid Sequence: DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88959.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-88959PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PPP2R5D

PP2A is a major serine/threonine phosphatase that is implicated in the negative control of cell cycle progression. It is a trimeric holoenzyme that is comprised of a catalytic, structural, and regulatory subunit. PPP2R5D is a regulatory subunit of PP2A. The regulatory subunits of PP2A are grouped into 3 families: B/PR55, B'/PR61, and B''/PR72. PPP2R5D encodes the delta isoform of the B' subunit, B56. PPP2R5D may function to localize PP2A to the nucleus. Alternate designations for PPP2R5D include serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform, PP2A B subunit B' delta isoform, PP2A B subunit B56 delta isoform, PP2A B subunit PR61 delta isoform, PP2A B subunit R5 delta isoform, B56D, MGC2134, and MGC8949.

Alternate Names

MGC2134, MGC8949, PP2A B subunit isoform B56-delta, PP2A B subunit isoform B'-delta, PP2A B subunit isoform PR61-delta, PP2A B subunit isoform R5-delta, PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, protein phosphatase 2, regulatory subunit B', delta, regulatory subunit B (B56), delta isoform, regulatory subunit B', delta isoform, Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, deltaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform

Gene Symbol

PPP2R5D

Additional PPP2R5D Products

Product Documents for PPP2R5D Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PPP2R5D Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...