Recombinant Human PRPF8 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00010594-P01

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00010594-P01 has been discontinued. View all PRPF8 products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all PRPF8 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-267 of Human PRPF8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSPPMPRSWLTTHLGMARRPLSSHAASRQAPVH

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

58.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PRPF8 GST (N-Term) Protein

SDS-PAGE: Recombinant Human PRPF8 GST (N-Term) Protein [H00010594-P01]

SDS-PAGE: Recombinant Human PRPF8 GST (N-Term) Protein [H00010594-P01]

SDS-Page: Recombinant Human PRPF8 Protein [H00010594-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00010594-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: PRPF8

Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. This gene is a candidate gene for autosomal dominant retinitis pigmentosa. [provided by RefSeq]

Alternate Names

apoptosis-regulated protein 1, apoptosis-regulated protein 2, p220, precursor mRNA processing protein, pre-mRNA-processing-splicing factor 8, Prp8, PRP8 homolog, PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae), PRP8 pre-mRNA processing factor 8 homolog (yeast), PRP8,220 kDa U5 snRNP-specific protein, PRPC8HPRP8, RP13, Splicing factor Prp8, U5 snRNP-specific protein (220 kD), ortholog of S. cerevisiae Prp8p

Gene Symbol

PRPF8

Additional PRPF8 Products

Product Documents for Recombinant Human PRPF8 GST (N-Term) Protein

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human PRPF8 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.