PRR7 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13815PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-13815PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all PRR7 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRR7.

Source: E. coli

Amino Acid Sequence: MSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13815.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13815PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PRR7

PRR7/TRAP3 (proline-rich 7, transmembrane adaptor protein 3) is a 28 kDa transmembrane adaptor protein ubiquitously expressed at low level (most in brain). Its amino acid sequence is extremely conserved among mammalian and other species. PRR7/TRAP3 contains potential palmitoylation motif and is found in lipid rafts. It is a part of the complex postsynaptic density fraction in neurons and associates with PSD-95, NMDA receptor and probably other proteins. The intracellular domain of PRR7/TRAP3 contains several tyrosines, a proline-rich sequence, and a C-terminal PDZ-binding motif. So far nothing is known about function of this protein. It may be involved in regulation of some receptor signaling and in formation of neurologic and immunologic synapse.

Alternate Names

MGC10772, proline rich 7 (synaptic), proline-rich protein 7, Synaptic proline-rich membrane protein

Gene Symbol

PRR7

Additional PRR7 Products

Product Documents for PRR7 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PRR7 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.