PTP epsilon Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87189PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87189PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all PTP epsilon Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPRE.

Source: E. coli

Amino Acid Sequence: NGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87189.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87189PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PTP epsilon

PTP epsilon, an R4 receptor protein tyrosine phosphatase, is composed of a short extracellular and two cyplasmic protein phosphatase domains and has been shown to affect neuronal differentiation, endothelial cell growth, vascular development, and possibly mammary tumor development. It has been shown that the cytosolic form of PTP epsilon can be induced by IL-1 and TNF alpha in humans and is a negative regulator of IL-6- and LIF-induced Jak-STAT kinase signaling in rats. Four alternatively spliced protein isoforms have been documented for PTP epsilon: a membrane form, a cytosolic form, the p65 form, which results from translation using an internal initiation codon, and the p67 form, which results from a specific proteolytic cleavage of wild-type PTP epsilon. PTP epsilon expression has been documented in human vascular endothelial cells, astrocytoma cells, and in IW32 erythroleukemia overexpressing p53. PTP epsilon expression has been documented in animal brain, breast, ganglion, heart, kidney, liver, lung, nerve, spinal cord, spleen, testis, and vessel. The membrane and cytosolic forms of PTP epsilon show different tissue expression patterns. ESTs have been isolated from numerous human tissue libraries, including normal human blood, brain, testis, and thyroid, and cancerous human blood, brain, breast, colon, embryo, head/neck, pancreas, and skin.

Alternate Names

DKFZp313F1310, EC 3.1.3.48, FLJ57799, FLJ58245, HPTPE, protein tyrosine phosphatase epsilon, protein tyrosine phosphatase, receptor type, E, protein tyrosine phosphatase, receptor type, epsilon polypeptide, Protein-tyrosine phosphatase epsilon, PTPE, receptor-type tyrosine-protein phosphatase epsilon, R-PTP-epsilon

Gene Symbol

PTPRE

Additional PTP epsilon Products

Product Documents for PTP epsilon Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PTP epsilon Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.