Recombinant Human PTTG1IP GST (N-Term) Protein

Name: Recombinant Human PTTG1IP GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000754-P02

Novus Biologicals, part of Bio-Techne | Catalog # H00000754-P02

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00000754-P02 has been discontinued. View all PTTG1IP products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all PTTG1IP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-180 of Human PTTG1IP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

46.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PTTG1IP GST (N-Term) Protein

SDS-PAGE: Recombinant Human PTTG1IP GST (N-Term) Protein [H00000754-P02]

SDS-Page: Recombinant Human PTTG1IP Protein [H00000754-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000754-P02

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: PTTG1IP

The encoded protein, which directly binds to pituitary tumor-transforming gene 1 protein (PTTG1), facilitates the nuclear translocation of PTTG1 and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. The gene product localizes to both the cytoplasm and nucleus. Its NLS is required for its own nuclear localization, the nuclear localization of PTTG1, and its interaction with PTTG1. [provided by RefSeq]

Alternate Names

C21orf1putative surface glycoprotein C21orf1 precursor10C21orf3pituitary tumor-transforming gene 1 protein-interacting protein, PBFPTTG-binding factor, pituitary tumor-transforming 1 interacting protein, Pituitary tumor-transforming gene protein-binding factor

Gene Symbol

PTTG1IP

Additional PTTG1IP Products

Product Documents for Recombinant Human PTTG1IP GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human PTTG1IP GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews