RAD54L2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58602PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58602PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all RAD54L2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD54L2.

Source: E. coli

Amino Acid Sequence: EHGYPVSGGFAMPPVSLNHNLTTPFTSQAGENSLFMGSTPSYYQLSNLLADARLVFPVTTDPLVPAGPVSSSSTATSVTASNPSFMLNPSVPGIL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58602.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58602PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RAD54L2

ARIP4 (androgen-interacting protein 4) was identified in a yeast two-hybrid screen using the human androgen receptor (AR) as bait. It was found to be a member of the SNF2 (sucrose nonfermenting 2) protein family and to have ATPase activity. ARIP4 is able to activate AR-dependent transcription. Targeted inactivation of ARIP4 results in embryonic lethality and reduced growth potential of embryonic fibroblast. These findings indicate an important role in development and proliferation. Alternate names for ARIP4 include RAD54-like protein 2, RAD54L2, and KIAA0809.

Alternate Names

Androgen receptor-interacting protein 4, ARIP4, EC 3.6.1, EC 3.6.4.12, FLJ21396, FLJ22400, helicase ARIP4, KIAA0809HSPC325, RAD54-like 2 (S. cerevisiae), RAD54-like protein 2, SRISNF2L

Gene Symbol

RAD54L2

Additional RAD54L2 Products

Product Documents for RAD54L2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RAD54L2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.