RCC2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49676PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-49676PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all RCC2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RCC2.

Source: E. coli

Amino Acid Sequence: ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49676.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-49676PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RCC2

RCC2 (regulator of chromosome condensation 2) is a member of the RCC1 family of guanine nucleotide exchange factors. RCC2 has been identified as part of the chromosomal passenger complex (CPC) which coordinates the chromosomal and cytoskeletal events of mitosis. Chromosomal passengers are proteins present in complexes with aurora B, inner centromeric protein (INCENP), survivin, and borealin. RCC2 has been demonstrated to be required for the recruitment of survivin and aurora B and is essential for proper chromosome segregation and the completion of cell cleavage. Loss of RCC2 inhibits spindle assembly, activates the spindle assembly checkpoint, and blocks cells in prometaphase.

Alternate Names

DKFZp762N0610, KIAA1470, protein RCC2, RCC1-like protein TD-60, regulator of chromosome condensation 2, TD60, TD-60, Telophase disk protein of 60 kDa

Gene Symbol

RCC2

Additional RCC2 Products

Product Documents for RCC2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RCC2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.