Reg1A Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13215PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human REG1A.
Source: E. coli
Amino Acid Sequence: PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13215.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-13215PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Reg1A
Reg1A, also known as PTP, PSP, and lithostathine, is a member of the Reg family of secreted proteins with a C-type lectin domain. Due to variable glycosylation, pancreatic Reg1A exists as multiple species of 16 - 18 kDa. Reg1A promotes the maintenance and growth of pancreatic islet β-cells and intestinal villi. It is upregulated in pancreatitis and some carcinomas. Reg1A is an antigenic target in autoimmune diabetes. Human Reg1A shares 65% - 68% aa sequence identity with mouse and rat Reg1A.
Long Name
Regenerating Islet-derived 1A
Alternate Names
ICRF, PSP, PTP
Gene Symbol
REG1A
Additional Reg1A Products
Product Documents for Reg1A Recombinant Protein Antigen
Product Specific Notices for Reg1A Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...