Skip to main content

Reg1A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13216PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13216PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human REG1A.

Source: E. coli

Amino Acid Sequence: TDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13216.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13216PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Reg1A

The Reg family constitutes a subset of the calcium-dependent C-type lectin superfamily. These small, secreted proteins have been implicated in a range of physiological processes including acting as acute phase reactants, lectins, survival/growth factors for insulin-producing pancreatic beta-cells, neural cells, and epithelial cells of the digestive system. Studies also indicate a role for Reg family members in tumor formation and indicate their potential for use as biomarkers of carcinogenesis.

Reg1A, also known as PTP, PSP, and lithostathine, is a member of the Reg family of secreted proteins with a C-type lectin domain. Due to variable glycosylation, pancreatic Reg1A exists as multiple species of 16 - 18 kDa. Reg1A promotes the maintenance and growth of pancreatic islet β-cells and intestinal villi. It is upregulated in pancreatitis and some carcinomas. Reg1A is an antigenic target in autoimmune diabetes. Human Reg1A shares 65% - 68% aa sequence identity with mouse and rat Reg1A.

Long Name

Regenerating Islet-derived 1A

Alternate Names

ICRF, PSP, PTP

Gene Symbol

REG1A

Additional Reg1A Products

Product Documents for Reg1A Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Reg1A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...