Skip to main content

RFX1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17759PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17759PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RFX1

Source: E. coli

Amino Acid Sequence: DASYTASAIRSSTYSYPETPLYTQTASTSYYEAAGTATQVSTPATSQAVASSGSMPMYVSGSQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17759.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17759PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RFX1

RFX1, also known as MHC class II regulatory factor RFX1, is a 105 kDa 979 amino acid protein found in the nucleus. The gene plays a significant role in the gene expression of MHC class II. Current research on RFX1 is being conducted in relation to hepatitis, leukemia, neuroblastoma , sickle cell anemia and adenocarcinoma. RFX1 has been linked to the methlation, immune response, spermatogenesis and localization pathways where it interacts with TADA3, SMAD1, HDAC1, ADD1 and SMAD9.

Alternate Names

EFC, EF-C, Enhancer factor C, MHC class II regulatory factor RFX, MHC class II regulatory factor RFX1, Regulatory factor X 1, regulatory factor X, 1 (influences HLA class II expression), RFX, trans-acting regulatory factor 1, Transcription factor RFX1

Gene Symbol

RFX1

Additional RFX1 Products

Product Documents for RFX1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RFX1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...