S100B Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87102PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87102PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all S100B Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100B.

Source: E. coli

Amino Acid Sequence: LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87102.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87102PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: S100B

S100B is a zinc- and calcium-binding protein belonging to the S100 protein family within the EF-hand (helix E-loop-helix F) subgroup (1,2). S100B plays a role in normal central nervous system development, is associated with various neurological diseases such as Alzheimer's and Parkinson's, and it serves as a marker for brain injury (1,2). The S100B protein has a homodimeric structure comprised of two 91-amino acid polypeptide monomers each with a theoretical molecular weight of 10.5 kDa (1,2). Furthermore, each monomer contains two EF-hand regions, four helixes, and a hinge region (2). S100B is predominately expressed in astrocytes, oligodendrocytes, and Schwann cells, but also other cell types including adipocytes (1,3). S100B interacts with toll-like receptor 4 (TLR4) and receptor for advanced glycation end products (RAGE), initiating downstream signaling cascades and transcription factors including JNK/JUN, NFkappaB, and p38, leading to caspase and proinflammatory cytokine production (2). Overall outcomes include neuronal apoptosis, neuroinflammation, and neurodegeneration (1,2). S100B is the most commonly studied astroglia and blood brain barrier biomarker in traumatic brain injury (TBI) (3,4). The serum levels of S100B in patients with TBI is indicative of patient outcomes, where high levels correlate with injury severity and mortality (4). S100B is often in used in combination with additional biomarkers such as glial fibrillary acidic protein (GFAP) and ubiquitin c-terminal hydrolase L1 (UCH-L1) (3,4).

References

1. Yardan, T., Erenler, A. K., Baydin, A., Aydin, K., & Cokluk, C. (2011). Usefulness of S100B protein in neurological disorders. JPMA. The Journal of the Pakistan Medical Association, 61(3), 276-281.

2. Langeh, U., & Singh, S. (2021). Targeting S100B Protein as a Surrogate Biomarker and its Role in Various Neurological Disorders. Current neuropharmacology, 19(2), 265-277. https://doi.org/10.2174/1570159X18666200729100427

3. Thelin, E. P., Nelson, D. W., & Bellander, B. M. (2017). A review of the clinical utility of serum S100B protein levels in the assessment of traumatic brain injury. Acta neurochirurgica, 159(2), 209-225. https://doi.org/10.1007/s00701-016-3046-3

4. Wang, K. K., Yang, Z., Zhu, T., Shi, Y., Rubenstein, R., Tyndall, J. A., & Manley, G. T. (2018). An update on diagnostic and prognostic biomarkers for traumatic brain injury. Expert review of molecular diagnostics, 18(2), 165-180. https://doi.org/10.1080/14737159.2018.1428089

Long Name

S100 Calcium Binding Protein B

Alternate Names

beta (neural), NEF, S100, S100 beta, S100 calcium binding protein B, S100 calcium-binding protein B, S100 calcium-binding protein, beta (neural), S-100 calcium-binding protein, beta chain, 10protein S100-B, S-100 protein beta chain, S-100 protein subunit beta, S100beta

Gene Symbol

S100B

Additional S100B Products

Product Documents for S100B Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for S100B Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.