Skip to main content

SCAMP5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13284PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13284PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCAMP5.

Source: E. coli

Amino Acid Sequence: GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13284.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13284PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SCAMP5

Secretory Carrier Membrane Proteins (SCAMPs) are proteins that are components of post Golgi membranes. These proteins are implicated to function in membrane trafficking. In fibroblasts, SCAMPs are concentrated in compartments that are involved in the recycling of cell surface receptors and endocytosis. In neurons, SCAMPs are associated with synaptic vesicles, secretion granules and transporter vesicles. SCAMPs are composed of four central transmembrane regions and a cytoplasmic tail. Of the five known SCAMPs, SCAMPs 1-3 contain cytoplasmic N-terminal regions with NPF repeats. NPF repeats are found to interact with EH domain proteins that function in budding of transport vesicles from the plasma membrane or the Golgi complex. SCAMPs 4 and 5 lack the N-terminal NPF repeats. SCAMPs 1-4 are all ubiquitously coexpressed while SCAMP 5 is only detectable in the brain. Studies show that SCAMP 5 is expressed late in development which is coincident with expansion of mature synapses.

Alternate Names

DKFZp686L1799, hSCAMP5, MGC24969, Sc5, secretory carrier membrane protein 5, secretory carrier-associated membrane protein 5

Gene Symbol

SCAMP5

Additional SCAMP5 Products

Product Documents for SCAMP5 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SCAMP5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...