Recombinant Human SCAP2 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00008935-P02
![SDS-PAGE: Recombinant Human SCAP2 GST (N-Term) Protein [H00008935-P02]](https://resources.bio-techne.com/images/products/qc_test-H00008935-P02-1.jpg "SDS-PAGE: Recombinant Human SCAP2 GST (N-Term) Protein [H00008935-P02]")
Discontinued Product
H00008935-P02 has been discontinued.
View all SCAP2 products.
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot
Product Specifications
Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-359 of Human SCAP2
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
65.12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human SCAP2 GST (N-Term) Protein
SDS-PAGE: Recombinant Human SCAP2 GST (N-Term) Protein [H00008935-P02]
SDS-Page: Recombinant Human SCAP2 Protein [H00008935-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation and Storage
H00008935-P02
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: SCAP2
Alternate Names
Fyn-associated phosphoprotein SKAP55 homologue, PRAP, RA70Pyk2/RAFTK-associated protein, Retinoic acid-induced protein 70, SAPSSKAP55 homolog, SCAP2MGC33304, SKAP55RSKAP-55HOM, SKAP-HOMMGC10411, src family associated phosphoprotein 2, Src family-associated phosphoprotein 2, src kinase associated phosphoprotein 2, src kinase-associated phosphoprotein 2, Src kinase-associated phosphoprotein 55-related protein, src kinase-associated phosphoprotein of 55-related protein, Src-associated adapter protein with PH and SH3 domains, src-associated adaptor protein
Gene Symbol
SKAP2
Additional SCAP2 Products
Product Documents for Recombinant Human SCAP2 GST (N-Term) Protein
Product Specific Notices for Recombinant Human SCAP2 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...