Skip to main content

SDCCAG8 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13288PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13288PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SDCCAG8.

Source: E. coli

Amino Acid Sequence: QLELEKLKLTYEEKCEIEESQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNVHMQTIERLVKERDDLMSAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13288.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13288PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SDCCAG8

SDCCAG8 is a gene that codes for a protein with four isoforms, with weights of 713, 360, 634, and 669 amino acids and weights of approximately 83, 41, 73, and 78 kDa respectively. The protein coded by SDCCAG8 helps in the formation of epithelial lumen as well as the establishment of cell polarity and is expressed in the thymus, prostate, testis, ovary, small intestine and mucosa as well as in colon and renal cancer tumors. Current studies are being done on several diseases and disorders linked to this gene including colon cancer, Senior-Loken syndrome, Bardet-Biegl syndrome, retinitis, nystagmus, eye disease, polydactyly, multiple sclerosis, and prostatitis. SDCCAG8 has also been shown to have interactions with TSC1, TRAF6, ALMS1, CEP152, and CEP164 in pathways such as the centrosome maturation, cell cycle, and G2/M transition pathways.

Alternate Names

CCCAPAntigen NY-CO-8, Centrosomal colon cancer autoantigen protein, hCCCAP, NPHP10, NY-CO-8, serologically defined colon cancer antigen 8, SLSN7

Gene Symbol

SDCCAG8

Additional SDCCAG8 Products

Product Documents for SDCCAG8 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SDCCAG8 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...