Recombinant Human SDHD GST (N-Term) Protein

Name: Recombinant Human SDHD GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00006392-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00006392-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all SDHD Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-159 of Human SDHD

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

43.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SDHD GST (N-Term) Protein

SDS-PAGE: Recombinant Human SDHD GST (N-Term) Protein [H00006392-P01]

SDS-Page: Recombinant Human SDHD Protein [H00006392-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00006392-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: SDHD

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane. Mutations in SDHD have been linked to hereditary paraganglioma. [provided by RefSeq]

Alternate Names

CBT1, CII-4, cybS, PGL, PGL1, QPs3, SDH4, succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, Succinate dehydrogenase complex subunit D, succinate dehydrogenase complex, subunit D, integral membrane protein, succinate dehydrogenase ubiquinone cytochrome B small subunit, Succinate-ubiquinone oxidoreductase cytochrome b small subunit, Succinate-ubiquinone reductase membrane anchor subunit

Gene Symbol

SDHD

Additional SDHD Products

Product Documents for Recombinant Human SDHD GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human SDHD GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews