Skip to main content

SFPQ Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48876PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48876PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SFPQ.

Source: E. coli

Amino Acid Sequence: IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48876.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48876PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SFPQ

PSF/SFPQ is a multifunctional protein know to participate in a variety of nuclear processes and may function to link transcription and pre-mRNA processing. PSF/SFPQ bears an RNA recognition motif (RRM) further indicating its role in post-transcriptional processes. PSF has been shown to associate with p54nrb/NonO to modulate androgen receptor-mediated transcription. Additionally, it has recently been show to associate with XRN2 and p54nrb/NonO to facilitate pre-mRNA 3' processing and transcription termination. Alternate names for PSF/SFPQ include polypyrimidine tract-binding protein-associated-splicing factor, PTB-associated-splicing factor, splicing factor proline-and glutamine-rich, and POMP100.

Alternate Names

100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich

Gene Symbol

SFPQ

Additional SFPQ Products

Product Documents for SFPQ Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SFPQ Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...