Skip to main content

SKAP55 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87836PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87836PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SKAP1.

Source: E. coli

Amino Acid Sequence: SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87836.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87836PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SKAP55

Src kinase-associated phosphoprotein of 55 kDa (SKAP55) is expressed as a constitutively tyrosine phosphorylated 55-kD adapter protein that positively regulates TCR signaling. SKAP55 has also been shown to enhance adhesion to fibronectin and ICAM1, colocalize with F-actin at the T cell-antigen-presenting cell synapse and promotes the clustering of LFA1 and TCR ligation. TCR engagement induces the translocation of SKAP55 to lipid rafts, where the interactions with Fyn take place. CD45 also plays a very important role in SKAP55/TCR-mediated signaling. SKAP55 involvement in the TCR signaling pathway is the subject of current research in murine as well as human models.

Long Name

Src Kinase-associated Phosphoprotein of 55 kDa

Alternate Names

SCAP1, SKAP1

Gene Symbol

SKAP1

Additional SKAP55 Products

Product Documents for SKAP55 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SKAP55 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...