Skip to main content

SMARCA1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56279PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56279PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMARCA1.

Source: E. coli

Amino Acid Sequence: KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56279.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56279PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SMARCA1

The SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin (SMARC), also called BRG1-associated factors (BAFs), have been identified as components of the human SWI/SNF-like chromatin-remodeling protein complexes. Member of this family have helicase and ATPase activities that alter chromatin structure to facilitate gene transcription. SMARCA1/SNF2L is a component of the human NURF (nucleosome remodeling factor) involved in the regulation of genes involved in neuronal development. SMARCA1/SNF2L is also a component of the heterodimeric complex CERF [CECR2(cat eye syndrome chromosome region, candidate 2)-containing remodeling factor]. Alternate names for SMARCA1/SNF2L include SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a1, SNF2, SNF2L, SNF2L1, SNF2LB, sucrose nonfermenting 2-like protein 1, NURF140, and ISWI.

Alternate Names

ATP-dependent helicase SMARCA1, DKFZp686D1623, EC 3.6.1, EC 3.6.4.-, FLJ41547, global transcription activator homologous sequence, Nucleosome-remodeling factor subunit SNF2L, NURF140, probable global transcription activator SNF2L1, SNF2L, SNF2L1ISWI, SNF2LB, SNF2-like 1, SNF2LT, subfamily a, member 1, sucrose nonfermenting 2-like protein 1, SWI, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 1, SWI2

Gene Symbol

SMARCA1

Additional SMARCA1 Products

Product Documents for SMARCA1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SMARCA1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...