Recombinant Human SPANXA1 GST (N-Term) Protein

Name: Recombinant Human SPANXA1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00030014-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00030014-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all SPANXA1 Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-97 of Human SPANXA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SPANXA1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human SPANXA1 GST (N-Term) Protein [H00030014-P01]

SDS-Page: Recombinant Human SPANXA1 Protein [H00030014-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00030014-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: SPANXA1

Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-head orientation with SPANX family member A2, which appears to be a duplication of the A1 locus. The protein encoded by this gene targets to the nucleus where it associates with nuclear vacuoles and the redundant nuclear envelope. Based on its association with these poorly characterized regions of the sperm nucleus, this protein provides a biochemical marker to study unique structures in spermatazoa while attempting to further define its role in spermatogenesis. [provided by RefSeq]

Alternate Names

B1, C, cancer/testis antigen family 11, member 1, CT11.1, CT11.2, CT11.3, CT11.4, CTp11, dJ171K16.1, member A1, NAP-X, nuclear-associated protein SPAN-Xa, SPANX, SPAN-X, SPANX family member A, SPANXA, SPAN-Xa, SPANX-A, SPANXA1 sperm protein associated with the nucleus, X-linked, family member A1, SPANXA2, SPANX-A2, SPANXB, SPAN-Xb, SPANX-B, SPANXC, SPANX-C, SPANXD, SPANX-D, sperm protein associated with the nucleus on the X chromosome A, sperm protein associated with the nucleus, X chromosome, family member A1, sperm protein associated with the nucleus, X-linked, family member A1

Gene Symbol

SPANXA1

Additional SPANXA1 Products

Product Documents for Recombinant Human SPANXA1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human SPANXA1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews