Recombinant Human Suppressor of Ty 4 homolog 1 GST (N-Term) Protein

Name: Recombinant Human Suppressor of Ty 4 homolog 1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00006827-P02

Novus Biologicals, part of Bio-Techne | Catalog # H00006827-P02

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all Suppressor of Ty 4 homolog 1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-117 of Human SUPT4H1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

39.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Suppressor of Ty 4 homolog 1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Suppressor of Ty 4 homolog 1 GST (N-Term) Protein [H00006827-P02]

SDS-Page: Recombinant Human Suppressor of Ty 4 homolog 1 Protein [H00006827-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00006827-P02

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Suppressor of Ty 4 homolog 1

Suppressor of Ty 4 homolog 1 is a component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGT

Alternate Names

DRB sensitivity-inducing factor 14 kDa subunit, DRB sensitivity-inducing factor small subunit, DSIF p14, DSIF small subunit, SPT4, SPT4HhSPT4, suppressor of Ty (S.cerevisiae) 4 homolog 1, suppressor of Ty 4 homolog 1 (S. cerevisiae), SUPT4H, transcription elongation factor SPT4

Gene Symbol

SUPT4H1

Additional Suppressor of Ty 4 homolog 1 Products

Product Documents for Recombinant Human Suppressor of Ty 4 homolog 1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Suppressor of Ty 4 homolog 1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews