Skip to main content

Tankyrase binding protein 1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-34041PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-34041PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNKS1BP1.

Source: E. coli

Amino Acid Sequence: EVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEERSLPSDLAFNGDLAKAASSELPAD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34041.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-34041PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Tankyrase binding protein 1

TAB182 (tankyrase 1-binding protein of 182 kDa) was identified in a two-hybrid screen in search of tankyrase 1-interacting proteins. Tankyrase 1 is a poly (ADP-ribose) polymerase (PARP) that ribosylates the negative regulator of telomere length, TRF1 (telomere-repeat binding factor). Ribosylation of TRF1 has been shown to result in the inhibition of TRF1 binding and an induction of telomere elongation. TAB182 and TRF1 bind multiple discrete and overlapping sites of the tankyrase 1 ankyrin domain. This finding suggests that TAB182 may act as a scaffold to mediate higher order protein complex formation at telomeres. TAB182 has also been suggested to serve a role in the cytoplasm as it has been found to localize to the cytoplasmic cortical actin network.

Alternate Names

KIAA1741TAB182FLJ45975,182 kDa tankyrase-1-binding protein, tankyrase 1 binding protein 1, 182kDa, tankyrase 1-binding protein of 182 kDa

Gene Symbol

TNKS1BP1

Additional Tankyrase binding protein 1 Products

Product Documents for Tankyrase binding protein 1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Tankyrase binding protein 1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...