TEM7/PLXDC1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86954PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-86954PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all TEM7/PLXDC1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLXDC1.

Source: E. coli

Amino Acid Sequence: RSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTPVHLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86954.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86954PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TEM7/PLXDC1

Recently, using SAGE (Serial Analysis of Gene Expression) technology, St. Croix et al, have identified 46 genes, whose expression is specifically elevated in tumor-associated endothelium. Nine of these genes were prominently expressed only in tumor endothelial cells (EC), but were absent or barely detectable in normal ECs, and named as Tumor Endothelial Markers (TEMs, TEM 1-9). TEM7 (Tumor endothelial marker 7) transcripts are specifically expressed in the endothelium of colorectal cancer, primary cancers of lung, pancreas, breast, and brain. TEM7 is expressed specifically in endothelium of these cancers, whether primary or metastasis. The other six members of this family (TEM1, 3, 4, 5, 8, and 9) also show similar expression pattern in lung and brain tumors, and liver metastasis. Since most of the genes expressed differentially in tumor endothelium are also expressed during angiogenesis, these newly discovered genes might provide important resources for basic and clinical studies of human angiogenesis.

Long Name

Tumor Endothelial Marker 7/Plexin Domain Containing Protein 1

Alternate Names

PLXDC1, TEM3

Gene Symbol

PLXDC1

Additional TEM7/PLXDC1 Products

Product Documents for TEM7/PLXDC1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TEM7/PLXDC1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.