Recombinant Human TET1 GST (N-Term) Protein

Name: Recombinant Human TET1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00080312-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00080312-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all TET1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2038-2136 of Human TET1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RNHPTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNELNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TET1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human TET1 GST (N-Term) Protein [H00080312-Q01]

SDS-Page: Recombinant Human TET1 Protein [H00080312-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00080312-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: TET1

TET1 (Ten-eleven translocation 1), also called methylcytosine dioxygenase TET1 or CXXC6, is one of three members of the human TET protein family of alpha-ketoglutarate oxygenases which includes TET2 and TET3 (1-3). TET1 is an enzyme that plays a role in epigenetic regulation of DNA methylation by conversion of 5-methylcytosine (5mC) to 5-hydroxymethylcytosine (5hmC), and further to 5-formylcystosine (5fC) and 5-carboxylcystosine (5caC) (1-5). The human TET1 protein is 2136 amino acids in length with a theoretical molecular weight of 235 kDa (6). Primary features of the TET1 protein include an N-terminal CXXC domain responsible for binding CpG islands in DNA, and a C-terminal catalytic domain containing a Cys-rich region followed by a double-stranded beta-helix (DSBH) domain that contributes to the mC dioxygenase activity and metal binding (1,2,4,5).

Recent studies have shown a role for TET1 in mediating epigenetic changes, such as DNA methylation status, in response to environmental factors such as food and nutrition, exercise, radiation, and allergens (3). The balance between DNA methylation and demethylation is crucial in health and homeostasis (3,5). In addition to response to environmental exposures, TET1 also plays a role in different diseases and cancer subtypes where it can function as either a tumor suppressor or tumor promoter (2,5). TET1 was originally identified as a fusion partner for the mixed lineage leukemia (MLL) gene in acute myeloid leukemia (AML) (1-3). While TET1 expression is low in AML, it is highly expressed in T-cell acute lymphoblastic leukemia (T-ALL) (2). Similarly, TET1 expression is suppressed in hormone receptor positive breast cancer (HRBC) but elevated in triple negative breast cancer (2). TET1 is a potential therapeutic target in certain cancers, but due to its complex role in different signaling pathways its potential needs to be more widely studied (2). While TET1 is primarily responsible for initiating DNA demethylation, it also functions alongside 5hmc in maintaining pluripotency in embryonic stem cells (ESCs) and can serve as a marker for differentiation (1,2,4,5).

References

1. Tan L, Shi YG. Tet family proteins and 5-hydroxymethylcytosine in development and disease. Development. 2012;139(11):1895-1902. https://doi.org/10.1242/dev.070771

2. Liu W, Wu G, Xiong F, Chen Y. Advances in the DNA methylation hydroxylase TET1. Biomark Res. 2021;9(1):76. https://doi.org/10.1186/s40364-021-00331-7

3. Zhu T, Brown AP, Ji H. The Emerging Role of Ten-Eleven Translocation 1 in Epigenetic Responses to Environmental Exposures. Epigenet Insights. 2020;13:2516865720910155. https://doi.org/10.1177/2516865720910155

4. Melamed P, Yosefzon Y, David C, Tsukerman A, Pnueli L. Tet Enzymes, Variants, and Differential Effects on Function. Front Cell Dev Biol. 2018;6:22. https://doi.org/10.3389/fcell.2018.00022

5. Ma C, Seong H, Liu Y, Yu X, Xu S, Li Y. Ten-eleven translocation proteins (TETs): tumor suppressors or tumor enhancers?. Front Biosci (Landmark Ed). 2021;26(10):895-915. https://doi.org/10.52586/4996

6. Uniprot (Q8NFU7)

Long Name

Methylcytosine dioxygenase TET1

Alternate Names

CXXC6, EC 1.14.11.n2, KIAA1676, LCX

Gene Symbol

TET1

Additional TET1 Products

Product Documents for Recombinant Human TET1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human TET1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews