Skip to main content

TFB2M Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-68602PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-68602PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TFB2M.

Source: E. coli

Amino Acid Sequence: HLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68602.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-68602PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TFB2M

S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA atthe conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction withPOLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, itactivates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity

Alternate Names

dimethyladenosine transferase 2, mitochondrial, EC 2.1.1.-, FLJ22661, FLJ23182, HCV NS5A-transactivated protein 5, Hepatitis C virus NS5A-transactivated protein 5, Hkp1, h-mtTFB, h-mtTFB2, hTFB2M, Mitochondrial 12S rRNA dimethylase 2, Mitochondrial transcription factor B2, mtTFB2, NS5ATP5, S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 2, transcription factor B2, mitochondrial

Gene Symbol

TFB2M

Additional TFB2M Products

Product Documents for TFB2M Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TFB2M Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...