THSD1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86930PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-86930PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all THSD1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human THSD1.

Source: E. coli

Amino Acid Sequence: VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86930.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86930PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: THSD1

Mouse THSD1 (Thrombospondin type-1 domain-containing protein 1), also known as Transmembrane molecule with thrombospondin module (Tmtsp), is a 95 kDa, type I transmembrane protein. It is synthesized as a precursor that is 851 amino acids (aa) in length, and has a 24 aa signal sequence, a 388 aa extracellular region, a 21 aa transmembrane region, and a 418 aa cytoplasmic region. The extracellular region contains six potential N-linked glycosylation sites and the thrombospondin type-1 (TSP1) domain, which is implicated in cell adhesion and migration. Also present in the molecule are 9 PKC-phosphorylation sites, 3 Ig-like domains, and a tyrosine-phosphorylation site by its C-terminus. Mouse THSD1 shares 78% aa sequence identity with human THSD1. THSD1 is highly expressed in hematopoietic stem cells (HSCs) and progenitor cells, including CD34-/lowKit+Sca-1+Lin- HSCs, CD34+Kit+Sca-1+Lin- and Lin- progenitor cells, and to a lesser degree in thymic CD4-CD8- cells. Expression gradually decreases during T cell differentiation. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1's ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand. THSD1 may function in primitive hematopoietic cells in the bone marrow niche, and through its TSP1 and Ig-like domains, it may play a role in HSC homing to the niche following cell-to-cell contact to maintain hematopoietic stem cell quiescence.

Long Name

Thrombospondin, Type I, Domain Containing 1

Alternate Names

TMTSP

Gene Symbol

THSD1

Additional THSD1 Products

Product Documents for THSD1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for THSD1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.