Thyroglobulin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-14784PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-14784PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Thyroglobulin Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TG.

Source: E. coli

Amino Acid Sequence: KMCSADYADLLQTFQVFILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14784.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-14784PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Thyroglobulin

Thyroglobulin is synthesized by the follicular epithelial cells of the thyroid. Thyroglobulin is the glycoprotein precursor to the thyroid hormones. Its synthesis and metabolism have seemingly wasteful features. It has a molecular weight of 660,000, with 2 identical subunits of MW 300,000 and 10% sugars; yet its complete hydrolysis yields only 2 to 4 molecules of the iodothyroxines T4 and T3. Baas et al. (1986) showed that the TG gene encodes an 8.7-kb mRNA, covers at least 300 kb of genomic DNA and contains at least 37 exons separated by introns as large as 64 kb. A striking structural difference between the 5-prime and 3-prime parts of the gene suggested that it is composed of 2 evolutionarily different regions. The first 30 kb of DNA encodes 3 kb of the mRNA yielding an exon:intron ratio of 1:10, whereas the remaining 270 kb encodes 5.7 kb of the mRNA with a ratio of 1.47.

Alternate Names

AITD3, cog, TDH3, Tg, TGN

Gene Symbol

TG

Additional Thyroglobulin Products

Product Documents for Thyroglobulin Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Thyroglobulin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.