TLK1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83035PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-83035PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all TLK1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TLK1.

Source: E. coli

Amino Acid Sequence: ETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83035.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-83035PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TLK1

Tousled-like kinase 1 (TLK1) is a serine/threonine kinase involved in chromatin assembly and the DNA damage response. The tousled (Tsl) kinase was first identified in Arabidopsis thaliana and speculated to be involved in cell division during patterning of plant organs. There are two tousled-like kinases in humans, TLK1 and TLK2, that can dimerize or heterodimerize for function and can be phosphorylated and inactivated by Chk1 in response to DNA damage. The histone chaperone, Asf1 (anti-silencing function 1), has been reported as a substrate for both TLK1 and TLK2. TLK1 has also been shown to be important for cell cycle progression and proper chromosome segregation.

Alternate Names

EC 2.7.11, EC 2.7.11.1, KIAA0137serine/threonine-protein kinase tousled-like 1, PKU-BETA, SNARE protein kinase SNAK, tousled-like kinase 1serine threonine protein kinase

Gene Symbol

TLK1

Additional TLK1 Products

Product Documents for TLK1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TLK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.