TLR7 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-32483PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-32483PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all TLR7 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TLR7.

Source: E. coli

Amino Acid Sequence: MLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32483.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-32483PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TLR7

Toll-like receptor 7 (TLR7) is a type I transmembrane protein expressed on the surface of endosomes and has a role in pathogen-associated molecular patterns (PAMPs) recognition and host defense (1-3). TLR7 is primarily expressed in the brain, placenta, spleen, stomach, and lungs (4). TLR7 recognizes microbial single stranded RNA (ssRNA), specifically guanosine and its derivatives (1-3). Human TLR7 cDNA encodes a 1049 amino acid (aa) protein with a theoretical molecular weight (MW) of 120.9 kDa (4). The TLR7 protein consists of a signal sequence, an 813 aa extracellular domain containing leucine-rich repeats (LRRs) which form a horseshoe-like shape, a 21 aa transmembrane domain, and a 189 aa cytoplasmic domain with cytosolic Toll-interleukin-1 receptor homology (TIR) domains (1,2,4). TLR7 and its fellow subfamily members, TLR8 and TLR9, possess a characteristic Z-loop between two LRRs with proteolytic Z-loop processing required for TLR activation (2). Z-loop cleavage in TLR7 allows for guanosine and uridine-rich ssRNA binding to the 1st and 2nd ligand binding site, respectively (2). The TIR domain associates with the adaptor protein myeloid differentiation primary response protein (MyD88) to initiate downstream signaling (1-3,5,6). Following activation by PAMPs, TLR7 dimerizes and bound MyD88 interacts with interleukin-1 receptor-associated kinase-4 (IRAK-4) (1,5). Together the complex recruits IRAK-1 and IRAK-2, which become phosphorylated, and interact with tumor necrosis factor receptor-associated factor 6 (TRAF6) (1,5). TRAF6 induces the activation of mitogen-activated protein kinase (MAPK), nuclear factor-kappaB (NF-kappaB), and interferon-regulatory factor 7 (IRF7), leading to interferon production and pro-inflammatory cytokine secretion associated with immune response (1,5).

While TLRs play an important role in innate immune response, dysfunction in the TLR-MyD88 signaling cascade has also been reported in various autoimmune disorders (5,6). Elevated expression of TLR7 is associated with increased risk of system lupus erythematosus (SLE), an autoimmune disease involving B cell hyperactivity (6,7). Studies involving mouse models has also found that increased TLR7 expression predisposes mice to a lupus-like disease (7). Therapeutics targeting TLR7 have been developed to either enhance or inhibit its activity depending on the circumstance. For example, TLR7 agonists such as imiquimod, resiquimod, and 852A are used to increase TLR7 activity for treatment of cancers and to fight viral infections (7,8). On the other hand, TLR7 antagonists inhibit its activation and have been developed to combat chronic immune stimulation as seen in inflammatory and autoimmune diseases (8).

References

1. Petes C, Odoardi N, Gee K. The Toll for Trafficking: Toll-Like Receptor 7 Delivery to the Endosome. Front Immunol. 2017;8:1075. https://doi.org/10.3389/fimmu.2017.01075

2. Maeda K, Akira S. TLR7 Structure: Cut in Z-Loop. Immunity. 2016;45(4):705-707. https://doi.org/10.1016/j.immuni.2016.10.003

3. Krieg AM, Vollmer J. Toll-like receptors 7, 8, and 9: linking innate immunity to autoimmunity. Immunol Rev. 2007;220:251-269. https://doi.org/10.1111/j.1600-065X.2007.00572.x

4. Uniprot (Q9NYK1)

5. Zheng C, Chen J, Chu F, Zhu J, Jin T. Inflammatory Role of TLR-MyD88 Signaling in Multiple Sclerosis. Front Mol Neurosci. 2020;12:314. https://doi.org/10.3389/fnmol.2019.00314

6. Chi H, Li C, Zhao FS, et al. Anti-tumor Activity of Toll-Like Receptor 7 Agonists. Front Pharmacol. 2017;8:304. https://doi.org/10.3389/fphar.2017.00304

7. Fillatreau S, Manfroi B, Dorner T. Toll-like receptor signalling in B cells during systemic lupus erythematosus. Nat Rev Rheumatol. 2021;17(2):98-108. https://doi.org/10.1038/s41584-020-00544-4

8. Patinote C, Karroum NB, Moarbess G, et al. Agonist and antagonist ligands of toll-like receptors 7 and 8: Ingenious tools for therapeutic purposes. Eur J Med Chem. 2020;193:112238. https://doi.org/10.1016/j.ejmech.2020.112238

Long Name

Toll-like Receptor 7

Alternate Names

toll-like receptor 7

Gene Symbol

TLR7

Additional TLR7 Products

Product Documents for TLR7 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TLR7 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.