Skip to main content

Recombinant Human TP53TG1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00011257-P01

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00011257-P01 has been discontinued. View all TP53TG1 products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-90 of Human TP53AP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MMLGSLAPDPGSRRHSGQAALRPRRYPTLWDRCRKRWLRPIFTQLLAAGLAYHTLLPIPSEPLFAAPGEHLHQCFVKESYCPPRVLAKEQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TP53TG1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00011257-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: TP53TG1

TP53TG1 is a gene that codes for a tumor p53-activated protein that has four isoforms, with lengths of 90, 36, 60, and 31 amino acids and weights of approximately 10, 4, 7, and 3 kDa respectively. Current studies are being done on diseases and disorders related to this protein including colon cancer. TP54TG1 has also been shown to have interactions with SAT1, PTPLAD1, and TP53.

Alternate Names

LINC00096, NCRNA00096, P53TG1, P53TG1-D, TP53 target 1 (non-protein coding), TP53AP1

Gene Symbol

TP53TG1

Additional TP53TG1 Products

Product Documents for Recombinant Human TP53TG1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human TP53TG1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...