Skip to main content

TRIM Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17096PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17096PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM

Source: E. coli

Amino Acid Sequence: IDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17096.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17096PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TRIM

TRIM is a 30 kD disulfide-linked protein also known as T cell receptor interacting molecule. TRIM is a type III membrane protein containing a very short extracellular domain (8 amino acids). TRIM is highly expressed in T cells with some expression also observed in NK cells. TRIM is a signaling adaptor molecule that links extracellular and intracellular signaling. The TRIM protein is phosphorylated by Src kinases and associates with the PI3K regulatory subunit alpha after phosphorylation. TRIM has also been shown to associate with TCR alpha, beta, and zeta. The TRIM-4 monoclonal antibody recognizes human TRIM and has been shown to be useful for Western blotting, intracellular staining by flow cytometry, and immunofluorescence staining.

Long Name

T Cell Receptor Interacting Molecule

Alternate Names

TCRIM, TRAT1

Gene Symbol

TRAT1

Additional TRIM Products

Product Documents for TRIM Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRIM Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...