Skip to main content

TRPC6 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55831PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-55831PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRPC6.

Source: E. coli

Amino Acid Sequence: WHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55831.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55831PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TRPC6

The protein encoded by the TRPC6 gene creates receptor-activated cation permeant calcium channels in the cell membrane. Isoform 1 is 931 amino acids in length and is approximately 106 kDa, while isoform 2 is 815 amino acids in lenth at around 93 kDA. Isoform 3 is 876 amino acids long and is just over 100 kDA. Focal segmental glomerulosclerosis 2 (FSGS2) is caused by deficits in the TRPC6 gene. This gene has been linked to diseases such as cystic fibrosis, gigantism, hypertension, kidney disease, glomerulosclerosis, pyloric stenosis, diencephalic neoplasm, premature ovarian failure, and hepatopulmonary syndrome. The TRPC6 gene interacts with MX1, ORAI1, NPHS1, NPHS2, and FYN genes in pathways that monitor sodium as well as calcium channels, EPO signaling pathway, G alpha (q) signaling events, signal transduction, and platelet homeostasis.

Long Name

Short transient receptor potential channel 6

Alternate Names

FSGS2, TRP-6, TRP6

Gene Symbol

TRPC6

Additional TRPC6 Products

Product Documents for TRPC6 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRPC6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...