Skip to main content

TSC2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56083PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56083PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TSC2.

Source: E. coli

Amino Acid Sequence: SQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56083.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56083PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TSC2

Tuberous sclerosis complex-2 (TCS2 also known as Tuberin) is a tumor suppressor that forms a complex with TSC1 (Hamartin ) and this complex is known to control various cellular functions including cell cycle, endocytosis, adhesion, and transcription (1). The C-terminal region of TSC2 contains a GTPase-activating protein (GAP) domain which interacts with Rap1, Rab5 and Rheb (2). The TSC1/TSC2 complex inhibits phosphorylation of S6kinase and 4E-BP1 through inactivation of mTOR (3). Additionally, binding of 14-3-3 beta to TSC2 at Ser1210 reduce the ability of the complex to inhibit phosphorylation of S6 kinase (4). Phosphorylation by ATK at Ser924 and Thr1518 inactivates TSC2 and disrupts its interaction with TSC1 (5). Tuberous sclerosis (TSC), an autosomal dominant disorder that affects 1 in 6000 individuals, is caused by a mutation in either the TSC1 or TSC2 tumor suppressor gene.

Long Name

Tuberous Sclerosis 2

Alternate Names

LAM, TSC4, Tuberin

Gene Symbol

TSC2

Additional TSC2 Products

Product Documents for TSC2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TSC2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...