Skip to main content

TUT1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56631PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56631PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TUT1.

Source: E. coli

Amino Acid Sequence: GWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPADRMLTVTPLQDPQGLFPDLHHFLQVFLPQAIR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56631.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56631PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TUT1

The TUT1 gene encodes a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A)polymerase. The encoded enzyme specifically adds and removes nucleotides from the 3' end of small nuclear RNAsand select mRNAs and may f

Alternate Names

EC 2.7.7.19, EC 2.7.7.52, FLJ21850, FLJ22267, FLJ22347, MGC131987, MGC149809, nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpharegulated-poly(A) polymerase, nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase, PAP-associated domain-containing 2, PAPD2, poly(A) polymerase associated domain containing 2, RBM21, RNA binding motif protein 21, RNA uridylyltransferase, RNA-binding motif protein 21, RNA-binding protein 21, speckle targeted PIP5K1A-regulated poly(A) polymerase, STARPAP, Star-PAP, terminal uridylyl transferase 1, U6 snRNA-specific, TUTase, U6 snRNA-specific terminal uridylyltransferase 1, U6 TUTase, U6-TUTase

Gene Symbol

TUT1

Additional TUT1 Products

Product Documents for TUT1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TUT1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...