Skip to main content

UBASH3B/STS1/Tula-2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-92456PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-92456PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBASH3B.

Source: E. coli

Amino Acid Sequence: AGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92456.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-92456PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: UBASH3B/STS1

Sts-1 is a protein that inhibits endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. Sts-1 and Sts-2 (formerly p70 and Clip4, respectively) have been found to interact with Cbl, an ubiquitin ligase that plays a critical role in attenuation of receptor tyrosine kinase signaling by inducing ubiquitination and promoting their sorting for endosomal degradation. Sts-1 and Sts-2 contain SH3 domains that interact with Cbl, Ub-associated domains, which bind directly to mono-Ub or to the EGFR/Ub chimera, as well as phosphoglycerate mutase domains that mediate oligomerization of Sts-1/2. Sts-1 and Sts-2 also have been found to negatively regulate signaling pathways that control T cell receptors, which in turn affect the extent and duration of the T cell response to foreign pathogens.

Long Name

Ubiquitin Associated and SH3 Domain Containing Protein B

Alternate Names

Cbl-interacting Protein p70, STS1

Gene Symbol

UBASH3B

Additional UBASH3B/STS1 Products

Product Documents for UBASH3B/STS1/Tula-2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for UBASH3B/STS1/Tula-2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...