Skip to main content

UCH-L1/PGP9.5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87334PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87334PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UCHL1.

Source: E. coli

Amino Acid Sequence: QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87334.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87334PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: UCH-L1/PGP9.5

Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) is a soluble cytoplasmic protein found in neurons and in cells of the diffuse neuroendocrine system, and their respective tumors. Therefore, UCH-L1 has been widely used as a peripheral nerve fiber marker. UCHL-1 functions as a tissue-specific ubiquitin carboxyl terminal hydrolase isoenzyme involved in the processing of both ubiquitin precursors and ubiquitinated proteins.

UCH L1 is down-regulated in brains from Parkinson disease and Alzheimer disease patients, and certian site specific mutations in the UCHL1 gene can either increase or decrese the risk of Parkinson's and/or Alzheimer's neurodegenerative diseases.

Human UCHL 1 and the closely related UCHL3 protein have one of the most complicated knot structures ever discovered, with five knot crossings. This knot structure is expected to help the protein resist degradation in the proteasome.

Long Name

Ubiquitin C-terminal Hydrolase L1

Alternate Names

PARK5, PGP9.5, UCHL1

Gene Symbol

UCHL1

Additional UCH-L1/PGP9.5 Products

Product Documents for UCH-L1/PGP9.5 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for UCH-L1/PGP9.5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...