VEGF-D Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86865PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-86865PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all VEGF-D Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FIGF.

Source: E. coli

Amino Acid Sequence: TGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETCCQKHKLFHPDT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86865.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86865PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: VEGF-D

Vascular Endothelial Growth Factor D (VEGFD), also known as c-fos-induced growth factor (FIGF), is a member of the VEGF family of growth factors. Vascular endothelial growth factors (VEGFs) are a family of closely related growth factors having a conserved pattern of eight cysteine residues and sharing common VEGF receptors. VEGFs stimulate endothelial cells, induce angiogenesis, promote cell migration, increase vascular permeability, and inhibit apoptosis. VEGFD is most closely related to VEGFC (23.3% amino acid sequence identity) and has a similar VEGF homology domain that spans the middle third of the precursor protein and the long N-terminal and C-terminal extensions. In adults, VEGFD is highly expressed in lung, heart, muscle, and small intestine. VEGFD expression in fibroblasts is induced by cell interaction mediated by cadherin 11. Recombinant human VEGFD is a ligand for the tyrosine kinases, VEGFR2 (Flk1) and VEGF receptor 3 (Flt4). Since VEGFR3 is strongly expressed in lymphatic endothelial cells, it is postulated that VEGFD is involved in the regulation of the growth and/or differentiation of lymphatic endothelium and thus, a mitogen for endothelial cells.

Long Name

Vascular Endothelial Growth Factor D/cFos-induced Growth Factor

Alternate Names

FIGF, VEGFD

Gene Symbol

VEGFD

Additional VEGF-D Products

Product Documents for VEGF-D Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for VEGF-D Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.