Skip to main content

ZKSCAN1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81346PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-81346PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZKSCAN1.

Source: E. coli

Amino Acid Sequence: NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81346.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-81346PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ZKSCAN1

ZKSCAN1 is a zinc-finger protein that contains six C2H2-type zinc fingers, a SCAN box domain, and a KRAB (kruppel-associated box) domain. Due to its structure, the function of ZKSCAN1is predicted to be involved in transcription. The KRAB domain is found in many C2H2-type zinc fingers and may be involved in mediating protein-protein reactions. The SCAN domain (named after SRE-ZBP, CTfin51, AW-1, and Number 18 cDNA) may also be involved in protein interactions due to its ability to mediate homo- and hetero-oligomerization. Alternative names for ZKSCAN1 include zinc finger protein with KRAB and SCAN domains 1, KOX18, ZNF139, ZNF36, and PHZ-37.

Alternate Names

KOX189130423L19Rik, PHZ-37, Zinc finger protein 139, Zinc finger protein 36, zinc finger protein 36 (KOX 18), Zinc finger protein KOX18, zinc finger protein with KRAB and SCAN domains 1, zinc finger with KRAB and SCAN domains 1, ZNF139, ZNF36MGC138429

Gene Symbol

ZKSCAN1

Additional ZKSCAN1 Products

Product Documents for ZKSCAN1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ZKSCAN1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...